PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P11160_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 667aa    MW: 72670.4 Da    PI: 6.5108
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P11160_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.67.3e-952946662374
                   GRAS   2 velLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..........sse 76 
                             +lL+e+A++v+++++  a+ +Larl+++    sp+g+p+ R a+yf+eAL+  l++ ++++ +a p+s+ ++++          +++
  GSMUA_Achr8P11160_001 294 ADLLFEAAKMVEARNFVGAHGILARLNHQlpsPSPSGKPLIRSAFYFKEALQLILSNGSNTILSATPTSHRQQSTfsaplmthldVVH 381
                            689*************************9988899**********************9999999999988888888999999999999 PP

                   GRAS  77 elaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeelee 160
                            +l+a+k+fsevsPi++fs++t+ qa+le+++g++r+Hi Dfdi+ G+QW +++q+La+R+    +   +l+iT+++s+ s+++ el+ 
  GSMUA_Achr8P11160_001 382 KLNAYKAFSEVSPIIQFSNFTCIQALLEELDGCDRIHIMDFDIGFGGQWSSFMQELAQRRcssaGAVRMLKITVFVSHYSHNNMELHL 469
                            99999******************************************************9887555679********9999******* PP

                   GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                            ++++L++fA+ l++pfe +v   ++l+++++ eL+   gEa+aVnl +   +l           + +L+lvk+lsPk+vv v+q +d+
  GSMUA_Achr8P11160_001 470 IQDNLSHFASDLNIPFELKV---RSLDSFDPLELHGLGGEAIAVNLPIGSANLS---------FPVLLRLVKQLSPKIVVSVDQGCDR 545
                            *******************8...899999999999999**********999885.........567********************** PP

                   GRAS 249 nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                            ++ +Fl++fl+a++   +l+ds++a+ ++++++++k+Er+ll+++i++ v  +  +      ++  Wr  +e+aGF p+++s+++++q
  GSMUA_Achr8P11160_001 546 SDLPFLQHFLHAFQSSLVLMDSIDAS-GTNQDTASKIERFLLQPKIESSVLGRYCA----ADKMLPWRTLFETAGFVPIQFSNFTETQ 628
                            *************************9.8999********************99998....88999*********************** PP

                   GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                            a++ll++v+ +g++ve++++sl+l+W++++LvsvSaWr
  GSMUA_Achr8P11160_001 629 AECLLKRVQIRGFHVEKRQASLYLYWQRKELVSVSAWR 666
                            *************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.929267646IPR005202Transcription factor GRAS
PfamPF035142.5E-92294666IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MRGLPYHGQG KGGLEAVETI FEGNQALFWV NKRPKLVIQQ GREPRSVLDH RSPSPPTSTA  60
TLSSSLGGGS SDTAGVAAVS DIPTNKWVLA DSTAEVSGGA VGKEEWAAEL QPIPTGLDMG  120
FVAGGEKCGL GVDDWEAILS ETSAASPGRE QTFFRWIMGD VDDPSAAGTA DEASVSAPTD  180
SSLPLSSNVA SGGGFSLAGN SISSPLSLPQ GMYFPDTLKR HPAIADQIPQ KLPFLDSAAN  240
SDLFLRRQSY QQQSHGFPLR QLQNRSVKPK VAAFVDDVTS AVAAQQLHLQ HALADLLFEA  300
AKMVEARNFV GAHGILARLN HQLPSPSPSG KPLIRSAFYF KEALQLILSN GSNTILSATP  360
TSHRQQSTFS APLMTHLDVV HKLNAYKAFS EVSPIIQFSN FTCIQALLEE LDGCDRIHIM  420
DFDIGFGGQW SSFMQELAQR RCSSAGAVRM LKITVFVSHY SHNNMELHLI QDNLSHFASD  480
LNIPFELKVR SLDSFDPLEL HGLGGEAIAV NLPIGSANLS FPVLLRLVKQ LSPKIVVSVD  540
QGCDRSDLPF LQHFLHAFQS SLVLMDSIDA SGTNQDTASK IERFLLQPKI ESSVLGRYCA  600
ADKMLPWRTL FETAGFVPIQ FSNFTETQAE CLLKRVQIRG FHVEKRQASL YLYWQRKELV  660
SVSAWRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2732966636375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009411560.10.0PREDICTED: scarecrow-like protein 27
TrEMBLM0TPG90.0M0TPG9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P11160_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-105GRAS family protein